Halobaculum magnesiiphilum: K6T50_11955 Help Entry K6T50_11955       CDS       T07527                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hmp  Halobaculum magnesiiphilum Pathway hmp03010   Ribosome Brite KEGG Orthology (KO) [BR:hmp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K6T50_11955   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K6T50_11955  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hmp03011]     K6T50_11955    04121 Ubiquitin system [BR:hmp04121]     K6T50_11955 Ribosome [BR:hmp03011]  Ribosomal proteins   Eukaryotes    Large subunit     K6T50_11955   Archaea     K6T50_11955 Ubiquitin system [BR:hmp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K6T50_11955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR zf-CHY Zn_Ribbon_1 DHHC Zn_ribbon_RPAB4 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  QZP37000 UniProt:  A0A8T8WAZ2 LinkDB All DBs Position complement(2350166..2350315) Genome browser AA seq 49 aa AA seqDB search MAQFDAAERRTLNKLICMRCNARNPQRAENCRKCGYGNLRPKAKEPRTA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcaattcgacgcggccgagcgccgcacgctcaacaagctcatctgcatgcggtgc aacgctcgcaacccccagcgcgcggagaactgtcgcaagtgcggctacgggaacctccgc cccaaggccaaggagccgcggaccgcgtaa

DBGET integrated database retrieval system