Helicobacter mustelae: HMU05470 Help Entry HMU05470          CDS       T01191                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hms  Helicobacter mustelae Pathway hms01100   Metabolic pathways hms01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hms00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HMU05470 (acpP)    00074 Mycolic acid biosynthesis     HMU05470 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HMU05470 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CBG39808 UniProt:  D3UH36 LinkDB All DBs Position 629240..629473 Genome browser AA seq 77 aa AA seqDB search MAVFDEVKEVVVEQLSVDANQVKPEAEFVKDLGADSLDVVELVMALEEKFGIEIPDEEAE KISTVGDVVSYIEANKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcggtttttgatgaagtaaaagaagttgtagtagagcagttgagtgtcgatgcgaat caagtgaagcctgaggcggaatttgtaaaagatttgggtgcagattcactggatgtagtt gagcttgtgatggccctggaagagaagtttggcattgagattccagatgaggaagcagag aaaatcagcactgttggggatgttgtgtcgtatatcgaggcaaacaaaaaataa

DBGET integrated database retrieval system