Hymenobacter monticola: MTP16_07975
Help
Entry
MTP16_07975 CDS
T08220
Name
(GenBank) TCR/Tet family MFS transporter
KO
K08151
MFS transporter, DHA1 family, tetracycline resistance protein
Organism
hmt
Hymenobacter monticola
Brite
KEGG Orthology (KO) [BR:
hmt00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
hmt02000
]
MTP16_07975
01504 Antimicrobial resistance genes [BR:
hmt01504
]
MTP16_07975
Transporters [BR:
hmt02000
]
Major facilitator superfamily (MFS)
Drug transporters
Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:
2.A.1.2
]
MTP16_07975
Antimicrobial resistance genes [BR:
hmt01504
]
Gene variants
Tetracycline resistance genes
Transporters
MTP16_07975
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
Sugar_tr
MFS_4
MOSP_N
Motif
Other DBs
NCBI-ProteinID:
UOE35579
UniProt:
A0ABY4B9Z4
LinkDB
All DBs
Position
complement(1893153..1894406)
Genome browser
AA seq
417 aa
AA seq
DB search
MASQRSPALGFIFITLLIDVSGLGIIIPVVPTLIRQLTGEGLSQAAVYSGWLTFAYAGAQ
FCFAPIMGGLSDKWGRRPVLLAALLGLGLDYIFLSFAPTLAWLFVGRVVAGITGASFTTA
TAYIADISTPENRAQNFGMVGVAFGLGFIIGPAVGGLLADFGARVPFMVAAGLSLCNFFY
GLLVLPESLAPDKRRAFAWTRANPVASLLRLKMYPAVLGLVASLVLIYLAGSSTQSVWTF
YTELKFGWGEKMVGISLGVIGLFSALVQGGLVRVAIPRLGAARAIVVGLLCYTVGFVLFA
FAWRGWLMLAFLAPYCLGGIAGPALQSTISGQVPANEQGELQGALTSLMSVTGVVGPLLM
TGLFRYFTRDNAPVHFPGAPFLLGAVMALASAALALRSFRRHPPVESSTVPAAVPAH
NT seq
1254 nt
NT seq
+upstream
nt +downstream
nt
atggcatcgcaacgctccccggcccttgggttcatcttcatcacgctgctgattgacgtc
agcgggctcggcatcatcattccggtggtgcccacgcttatccggcagctcacgggcgag
gggctgagccaggcagcggtgtattcgggctggctcacgtttgcttacgccggggcacag
ttctgttttgcgcctattatgggcgggctcagcgacaagtgggggcggcggccggtgctg
ctggcggcgttgctggggctggggctcgactacatcttcctgagctttgcccccaccctg
gcctggctgtttgtggggcgcgtggtggcgggcatcacgggggccagcttcaccacggcc
acggcctacattgccgacatcagcacgcccgagaaccgggcccagaactttggcatggtg
ggcgtggcatttgggctgggcttcatcatcgggccggcggtgggcgggctgctggcggat
tttggcgcgcgggtgccgtttatggtggcggcggggctgagcttgtgcaacttcttctac
ggcctgttggtgctgcccgagtcgctggcgcccgacaagcgccgggcctttgcctggacg
cgggccaaccccgtggcctcgctgctgcggctgaaaatgtacccggcggtgctgggcctg
gtggcctcgctggtgctcatctacctggcaggttcttctactcaatcggtctggacgttt
tacaccgagctcaagtttggctggggcgagaagatggtgggcatttcgctgggcgttatc
ggactgttttcggcgctggtgcagggcgggctggtgcgcgtggccatccccaggctgggc
gcggcgcgggccatagtggtggggctgctgtgctacacggtgggcttcgtgctgtttgcc
tttgcctggcggggctggctgatgctagcgtttctggcgccctactgcctgggcggcatc
gcgggaccggcgctgcaaagcaccatttcgggccaggtgccggccaacgagcagggcgag
ctgcagggcgccctcaccagcctgatgagcgtgaccggcgtggtgggcccgctgctgatg
acgggcctgttccgctacttcacccgcgacaacgcgccggtgcatttcccaggcgcccca
tttttgctgggggcggtgatggcgctggccagcgcggcactggcgctgcgctcgtttcgc
cggcacccgccggtggaaagcagcaccgtgcccgccgccgtgcccgcgcattga
DBGET
integrated database retrieval system