Halomicrobium mukohataei: Hmuk_1172 Help Entry Hmuk_1172         CDS       T00982                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hmu  Halomicrobium mukohataei Pathway hmu03010   Ribosome Brite KEGG Orthology (KO) [BR:hmu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Hmuk_1172   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Hmuk_1172  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hmu03011]     Hmuk_1172    04121 Ubiquitin system [BR:hmu04121]     Hmuk_1172   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmu04147]     Hmuk_1172 Ribosome [BR:hmu03011]  Ribosomal proteins   Eukaryotes    Small subunit     Hmuk_1172   Archaea     Hmuk_1172 Ubiquitin system [BR:hmu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Hmuk_1172 Exosome [BR:hmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Hmuk_1172   Exosomal proteins of colorectal cancer cells    Hmuk_1172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 Ribosomal_L37e DUF7479 Zn_ribbon_3 DZR_2 zf-C2H2_FBX41 Cas12f1-like_TNB Zn_Ribbon_TF DZR zf-C2H2_ZN142 HypA DUF5817 Zn-ribbon_GIR1 Motif Other DBs NCBI-ProteinID:  ACV47298 UniProt:  C7P269 LinkDB All DBs Position 1115357..1115491 Genome browser AA seq 44 aa AA seqDB search MARHEYYSDDGQIEREQCPRCGDTFLAEHDDRKHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgtcacgagtactacagcgacgacggtcagatcgaacgcgagcagtgcccccgg tgtggcgacaccttcctcgccgagcacgacgaccgcaaacactgcggcaagtgcggctac accgagtgggagtaa

DBGET integrated database retrieval system