Halothiobacillus neapolitanus: Hneap_0063 Help Entry Hneap_0063        CDS       T01104                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hna  Halothiobacillus neapolitanus Pathway hna01100   Metabolic pathways hna01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hna00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hneap_0063    00074 Mycolic acid biosynthesis     Hneap_0063   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hneap_0063 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACX94929 UniProt:  D0KW02 LinkDB All DBs Position 70516..70800 Genome browser AA seq 94 aa AA seqDB search MTDLSQKITDQALVEELANLIVDGLNLEVSAAEIDADAPLFGQGLGLDSIDILEIAMMVS KRYGFALRSDDENNTRIFSSLRHLAQHIAEHRSC NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgatttaagtcaaaaaattacagaccaggcattggttgaagagctggcaaatctg attgtcgatgggttgaatttggaagtcagcgcggcggagatcgatgccgatgccccctta tttgggcagggtctcgggcttgactccatcgatattcttgaaattgcgatgatggtgtcc aaacgctacggtttcgccctgcgcagcgacgatgagaacaacacgcggattttttcttcg ctccggcacttggcgcagcatatcgccgagcatcgcagctgttaa

DBGET integrated database retrieval system