Hyphomonas neptunium: HNE_1591 Help Entry HNE_1591          CDS       T00397                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hne  Hyphomonas neptunium Pathway hne00998   Biosynthesis of various antibiotics hne01100   Metabolic pathways hne01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hne00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNE_1591 (acpP1)    00074 Mycolic acid biosynthesis     HNE_1591 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNE_1591 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7667 Motif Other DBs NCBI-ProteinID:  ABI76753 UniProt:  Q0C1U2 LinkDB All DBs Position complement(1623278..1623535) Genome browser AA seq 85 aa AA seqDB search MTSRTDQTAIFEDVAKILAARSHTQAVILPDTRIGADLEIDSVEIFDIVMELEDLYNISL PVEAASDIDTVKDLVAKIGQLANVR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacctcaagaacagatcaaaccgcgatctttgaagatgtcgccaagatactcgccgcc cgtagccatactcaggcagtcattctccccgatacgcgaataggcgccgacctggaaata gactccgtggagatattcgacatcgttatggagctggaagacctttacaatatttccctg cctgtcgaagctgcttccgatattgataccgtcaaagaccttgttgcaaaaataggacag ctcgcaaatgttcgatag

DBGET integrated database retrieval system