Hyphomonas neptunium: HNE_2157 Help Entry HNE_2157          CDS       T00397                                  Symbol acpP3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hne  Hyphomonas neptunium Pathway hne00998   Biosynthesis of various antibiotics hne01100   Metabolic pathways hne01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hne00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNE_2157 (acpP3)    00074 Mycolic acid biosynthesis     HNE_2157 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNE_2157 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  ABI76503 UniProt:  Q0C089 LinkDB All DBs Position complement(2246184..2246417) Genome browser AA seq 77 aa AA seqDB search MSDVFERVKKIVVENLDVEADKVVESASFIDDLGADSLDLVELVMAFEEEFNIEIPDDVQ ESIRSVGDAVSHIKAHV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgtttttgaacgtgtgaagaaaatcgtagtcgagaacctcgacgtggaagca gacaaggttgttgagagcgcaagcttcatcgacgacctcggtgcggactcgctggacctc gtcgaactcgtgatggctttcgaagaagagtttaacatcgagatccctgatgacgtgcaa gagtcgatccgttcggtcggtgacgccgtctcgcacatcaaggcccacgtctaa

DBGET integrated database retrieval system