Hyphomonas neptunium: HNE_2764 Help Entry HNE_2764          CDS       T00397                                  Symbol ssb Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism hne  Hyphomonas neptunium Pathway hne03030   DNA replication hne03430   Mismatch repair hne03440   Homologous recombination Brite KEGG Orthology (KO) [BR:hne00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     HNE_2764 (ssb)    03430 Mismatch repair     HNE_2764 (ssb)    03440 Homologous recombination     HNE_2764 (ssb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hne03032]     HNE_2764 (ssb)    03400 DNA repair and recombination proteins [BR:hne03400]     HNE_2764 (ssb)    03029 Mitochondrial biogenesis [BR:hne03029]     HNE_2764 (ssb) DNA replication proteins [BR:hne03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HNE_2764 (ssb) DNA repair and recombination proteins [BR:hne03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      HNE_2764 (ssb)   TLS (translesion DNA synthesis) factors    Other SOS response factors     HNE_2764 (ssb) Mitochondrial biogenesis [BR:hne03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     HNE_2764 (ssb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  ABI75779 UniProt:  Q0BYK0 LinkDB All DBs Position complement(2924846..2925337) Genome browser AA seq 163 aa AA seqDB search MAGSVNKVILVGNLGADPEVKQFQNGGQVCNLRIATSETWRDKASGERKERTEWHTVAIF SEGLVKVAQSYLKKGSKVYLEGKLQTRKWQDKDGNDRYTTEIVLQGFDATLVMLDGRGEG GGASAGGGGRDMGYSGGGNGGGRQQMSGPKESFSQDLDDEIPF NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atggcgggatcggtaaacaaggtcattctggtgggcaatctcggggctgaccccgaagtg aagcagttccagaatggcgggcaggtctgcaacctgcgcatcgcaacctcggaaacctgg cgcgacaaggcgtcgggcgagcgcaaggagcgcaccgaatggcacaccgtggccatcttt tccgaaggcctggtcaaggttgcccagagttatctgaaaaagggctccaaggtttatctt gagggcaagctgcagacccgcaaatggcaggacaaggacggcaacgaccggtacacgacc gagattgtcctgcagggctttgatgccacgctggtgatgctcgacggtcgcggcgaaggc ggcggcgccagtgccggcggcggtggccgtgacatgggctattcgggcggcggcaatggc ggcggacgccagcagatgagcggcccgaaagaaagcttcagccaggatctcgacgacgag atcccgttctga

DBGET integrated database retrieval system