Hyphomicrobium nitrativorans: W911_11025 Help Entry W911_11025        CDS       T02943                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism hni  Hyphomicrobium nitrativorans Pathway hni02024   Quorum sensing hni03018   RNA degradation Brite KEGG Orthology (KO) [BR:hni00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     W911_11025  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     W911_11025  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hni03019]     W911_11025    03036 Chromosome and associated proteins [BR:hni03036]     W911_11025 Messenger RNA biogenesis [BR:hni03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      W911_11025 Chromosome and associated proteins [BR:hni03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     W911_11025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  AHB48811 UniProt:  V5SD70 LinkDB All DBs Position 2292260..2292505 Genome browser AA seq 81 aa AA seqDB search MAADRAQNLQDTFLNHVRKSKTPLTIFLVNGVKLQGIVTWFDNFCVLLRRDGHSQLVYKH AISTIMPGAPVHLMEAESDGQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccgcagatcgcgctcagaacctccaggacaccttcctcaatcacgtccgcaaaagc aaaacgcccctcacgatttttctcgtcaacggggtcaagcttcaaggcattgtgacctgg ttcgataatttttgcgtactccttcgcagagacgggcattcgcagctggtttataagcat gcgatctcgaccatcatgccgggtgcgccggttcatttgatggaagcggagtccgacgga cagtaa

DBGET integrated database retrieval system