Halobacterium noricense: LT974_13530 Help Entry LT974_13530       CDS       T07823                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hno  Halobacterium noricense Pathway hno03010   Ribosome Brite KEGG Orthology (KO) [BR:hno00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LT974_13530   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LT974_13530  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hno03011]     LT974_13530    04121 Ubiquitin system [BR:hno04121]     LT974_13530   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hno04147]     LT974_13530 Ribosome [BR:hno03011]  Ribosomal proteins   Eukaryotes    Small subunit     LT974_13530   Archaea     LT974_13530 Ubiquitin system [BR:hno04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LT974_13530 Exosome [BR:hno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LT974_13530   Exosomal proteins of colorectal cancer cells    LT974_13530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_TF Rcat_RNF216 Ribosomal_L37e Zn_ribbon_RPB9 Zn_Ribbon_1 DZR_2 Zn_ribbon_19 FYVE Cas12f1-like_TNB DZR zf-C2H2_FBX41 HypA zf_UBZ Motif Other DBs NCBI-ProteinID:  UHH24991 LinkDB All DBs Position complement(2517217..2517351) Genome browser AA seq 44 aa AA seqDB search MPRSDYYNDDGTADKEMCPRCGDTFLADHGDRQYCGKCGYTEWD NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccgcggagcgactactacaacgacgacgggacggcggacaaggagatgtgcccgcgc tgcggtgacaccttcctcgcagaccacggcgaccggcagtactgcgggaagtgcggctac accgagtgggactga

DBGET integrated database retrieval system