Vreelandella neptunia ATCC BAA-805: SR894_02290 Help Entry SR894_02290       CDS       T09634                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism hnp  Vreelandella neptunia ATCC BAA-805 Pathway hnp03030   DNA replication hnp03430   Mismatch repair hnp03440   Homologous recombination Brite KEGG Orthology (KO) [BR:hnp00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     SR894_02290    03430 Mismatch repair     SR894_02290    03440 Homologous recombination     SR894_02290  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hnp03032]     SR894_02290    03400 DNA repair and recombination proteins [BR:hnp03400]     SR894_02290 Enzymes [BR:hnp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      SR894_02290 DNA replication proteins [BR:hnp03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      SR894_02290 DNA repair and recombination proteins [BR:hnp03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      SR894_02290 SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol3_chi KilB Motif Other DBs NCBI-ProteinID:  WQH13382 UniProt:  A0ABZ0YPZ6 LinkDB All DBs Position complement(470199..470630) Genome browser AA seq 143 aa AA seqDB search MARIDFYILPDTTLEARLQFACKLAETIWRKGYRLHLHCEDKALAEQADNALWNFRPDAY LPHALEDSEMAASVPITLGWQQLPVPTEEAALLNLHPEIPEGVERYARIAEIINQHQQVL IAKRACWQRYKEMGHEVVPHKLG NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcattgatttctacattctgcccgataccaccctggaggcgcgcttgcagttc gcttgcaaactggccgagaccatctggcgcaaaggctaccgcctgcatctccactgtgaa gacaaagccctcgccgagcaggccgataacgcgctatggaatttccgcccggacgcctat ttaccccatgccctggaagatagcgagatggccgccagcgtccccatcacgctaggctgg cagcagttaccggtgcccacggaagaggccgcactgcttaatttacaccccgaaataccc gaaggcgtagagcgctacgcgcgaattgccgagatcatcaatcagcaccagcaagtcctg atcgccaaacgcgcctgctggcagcgctataaagaaatgggccacgaggttgtgccgcat aagttggggtag

DBGET integrated database retrieval system