Vreelandella neptunia: SR894_07685 Help Entry SR894_07685       CDS       T09634                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hnp  Vreelandella neptunia Pathway hnp01100   Metabolic pathways hnp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hnp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SR894_07685 (acpP)    00074 Mycolic acid biosynthesis     SR894_07685 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SR894_07685 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  WQH14410 LinkDB All DBs Position 1681785..1682018 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagttgtagcagagcgcctgaacgttaaagaa gaagacatccaaaacagctcttcttttacagaagacttgggtgctgattcgctcgacacc gttgagctggtcatggctttggaagaggaattcgatactgaaattcccgatgaagaagct gagaagatcaccacggttcaagaagccatcgattacgtgaacgcccaccagtaa

DBGET integrated database retrieval system