Halobacillus naozhouensis: P9989_02495 Help Entry P9989_02495       CDS       T09043                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism hnz  Halobacillus naozhouensis Brite KEGG Orthology (KO) [BR:hnz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hnz03110]     P9989_02495 (groES)    03029 Mitochondrial biogenesis [BR:hnz03029]     P9989_02495 (groES) Chaperones and folding catalysts [BR:hnz03110]  Heat shock proteins   HSP10    P9989_02495 (groES) Mitochondrial biogenesis [BR:hnz03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     P9989_02495 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DPOA2_OB Motif Other DBs NCBI-ProteinID:  WFT75286 LinkDB All DBs Position 442674..442958 Genome browser AA seq 94 aa AA seqDB search MLKPLGDRIVIELVEEEQTTASGIVLPDSAKEKPQEGKIVAVGTGRVTDNGEKIALEVSQ GDHIIYSKFAGTEVKYEGNEYLIIRESDILAVVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgttaaagccactaggtgatcgtattgtaattgaattagtagaggaagaacaaactact gcaagcggtatcgtgcttccagactctgcgaaagaaaagcctcaagaaggtaaaatcgta gcggttggaacaggtcgtgtaacggataacggtgagaagattgcacttgaagtttcacaa ggtgatcatatcatctattctaagtttgcaggtactgaagtaaaatatgaaggcaatgaa tacttaatcattcgcgaaagtgatattttagcagtcgttcagtaa

DBGET integrated database retrieval system