Halobacillus naozhouensis: P9989_10245 Help Entry P9989_10245       CDS       T09043                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hnz  Halobacillus naozhouensis Pathway hnz01100   Metabolic pathways hnz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hnz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P9989_10245 (acpP)    00074 Mycolic acid biosynthesis     P9989_10245 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P9989_10245 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  WFT76706 UniProt:  A0ABY8J6W8 LinkDB All DBs Position 1949802..1950035 Genome browser AA seq 77 aa AA seqDB search MAETFDRVKQIIVDRLDADESKVTMEASFKEDLEADSLDVVELVMELEDEFDMEISDEEA EKINTVGDAVNYINSVS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagaaacatttgatcgcgtaaaacaaatcattgtcgatcgtctagatgcagacgaa tctaaagttacaatggaagcttccttcaaagaagatctagaagcagactctcttgacgta gtagaattagtaatggagctcgaagatgagtttgatatggaaatctctgatgaagaagct gaaaaaatcaatacggttggcgacgctgtgaattacataaacagtgtatcctaa

DBGET integrated database retrieval system