Hoeflea alexandrii: ABWH89_00050
Help
Entry
ABWH89_00050 CDS
T11168
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
hoax Hoeflea alexandrii
Pathway
hoax02020
Two-component system
hoax02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
hoax00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
ABWH89_00050
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
ABWH89_00050
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
hoax02022
]
ABWH89_00050
02035 Bacterial motility proteins [BR:
hoax02035
]
ABWH89_00050
Enzymes [BR:
hoax01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
ABWH89_00050
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
ABWH89_00050
Two-component system [BR:
hoax02022
]
CheA family
CheA-CheYBV (chemotaxis)
ABWH89_00050
Bacterial motility proteins [BR:
hoax02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
ABWH89_00050
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
Response_reg
T2SSE
Motif
Other DBs
NCBI-ProteinID:
XHC37762
LinkDB
All DBs
Position
complement(7060..8127)
Genome browser
AA seq
355 aa
AA seq
DB search
MTARTRVLVVDDSPTMRSLIRAVLRSDPGIEVVGEAADALEARSAIKQLNPDVITLDVEM
PNMNGIEFLDKIMKLRPMPVIMVSTLTQRGAEATLAALEIGAFDCIGKPLPGDPQPFAGL
AETVKAAARSQRHLPEPVVGGQPVAAAPAYSAPSDYQPARKIIAIGASTGGVEALIAVLT
KFPANCPPTVITQHMPATFTKSFAERLNRLCAPQVKEAEDGDRLEIGRIYLAPGGDRHME
ISNPTAPRCMLVEGGPVNGHRPSVDVMFQSVARLAGRKAVGIILTGMGRDGAAGLLEMHK
AGATTIGQNEKTCVVYGMPRVAHEIGAVDFQLPLNQIGEEVLKSTTTTSRKDRVA
NT seq
1068 nt
NT seq
+upstream
nt +downstream
nt
atgacagcacgcacccgtgtacttgttgtagacgactctccgacgatgcggagcttgatc
agggcggttctgcgttccgatccgggcatcgaggttgtgggcgaggccgccgacgcactt
gaagcgcggtcggcgataaagcagctcaaccccgatgtgatcactctcgacgtcgagatg
ccgaacatgaacggcatcgagtttctcgacaagatcatgaagctccggccgatgccggtg
atcatggtgtccacgctgacgcagcgcggcgccgaggccaccctggccgcgcttgagatc
ggcgctttcgactgcatcggcaagcccttgcccggcgacccgcagccattcgcgggactg
gccgagaccgtcaaggcggccgcgcgttcgcagcgccacttgcctgagccggtggtcggt
gggcagcctgtcgctgccgctccggcctactcggcacccagcgactaccagccggcccgc
aagatcattgccatcggggcatcgaccggtggtgtcgaggcattgatcgcggtgctgacg
aagtttccggccaattgccctccgacggtcattactcagcacatgcccgccacatttacc
aagagcttcgccgaaaggctcaaccggctgtgtgctccccaggtcaaggaggccgaagat
ggcgaccgtctcgagatcggccgcatctacctggcgccgggcggtgaccgtcacatggag
atatccaacccgacagcgccgcgctgcatgctggtcgaaggtggacccgtgaacggacac
cggccttccgtcgatgtcatgttccagtcggtcgcccggctcgcagggcgcaaggcggtc
gggatcatcctgacgggaatgggccgtgatggtgcggccggactgctcgaaatgcacaag
gctggcgccaccaccatcggccagaacgaaaaaacctgtgtcgtctacggcatgccgcgc
gtcgcgcacgaaatcggtgccgtcgatttccagttgcctcttaatcagattggggaagaa
gtcctcaagtcaacaactacaacctctcgcaaagatagggtcgcgtga
DBGET
integrated database retrieval system