Hemiscyllium ocellatum (epaulette shark): 132816367
Help
Entry
132816367 CDS
T09720
Name
(RefSeq) collagen alpha-6(IV) chain-like isoform X1
KO
K06237
collagen type IV alpha
Organism
hoc
Hemiscyllium ocellatum (epaulette shark)
Pathway
hoc04382
Cornified envelope formation
hoc04510
Focal adhesion
hoc04512
ECM-receptor interaction
hoc04820
Cytoskeleton in muscle cells
Brite
KEGG Orthology (KO) [BR:
hoc00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04512 ECM-receptor interaction
132816367
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
132816367
09142 Cell motility
04820 Cytoskeleton in muscle cells
132816367
09150 Organismal Systems
09158 Development and regeneration
04382 Cornified envelope formation
132816367
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
hoc04147
]
132816367
00536 Glycosaminoglycan binding proteins [BR:
hoc00536
]
132816367
Exosome [BR:
hoc04147
]
Exosomal proteins
Exosomal proteins of other cancer cells
132816367
Glycosaminoglycan binding proteins [BR:
hoc00536
]
Heparan sulfate / Heparin
Extracellular matrix molecules
132816367
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Collagen
C4
Motif
Other DBs
NCBI-GeneID:
132816367
NCBI-ProteinID:
XP_060681816
LinkDB
All DBs
Position
6:complement(15471231..15677446)
Genome browser
AA seq
1699 aa
AA seq
DB search
MWCLLLRLLILLLLTDTILAGGKSYLGPCNGRDCSAGCQCFPEKGARGRPGAPGSQGPQG
PPGPPGRQGVAGHKGAKGDRGKPGVTGQTGDKGPMGVPGFAGNDGIPGHPGQPGPRGPPG
HDGCNGTRGDPGATGQPGFPGLLGISGVPGRKGQKGEPFLVTVEWRRFRGDAGLPGLPGY
PGLPGNPGEMGLNGPPGAMGPVGRPGPPGPPGPKGNDGIGFQGRTGEKGEPGPPGLPGSR
IEDTSQVSALGNKTGEKGDRGEPGNEGEFGDPGEPGTPGPKGEKGEEGIMGLPGLRGESG
FNGPPGSEGRKGLPGIPGLPGFNGQPGLKGDRGDPGQPGQSITFTGLIPKGPKGWPGLEG
ERGPKGEEGFYGHEGSSGLPGETAPFPGNPGPPGLPGFSGAKGEKGDQGLPALQPGFPGF
PGKSGPPGPPGPPGPIGSTEFIGDPGEEGQRGYPGPRGRPGDKGDRGHCACDVDGASPVG
PRGPAGAPGYPGIPGVDGQPGDEGSPGPFGAPGIQGVTGEAGAHGPKGQKGDSVFISTIT
TKGSKGEQGHPGLTGRPGEPGIPGNDGKPGRQGYPGIPGDALEGYPGDVGSPGVLGRKGI
PGRPGLPGVGIQGPRGRPGPPGDFGPAGTPGIPGLPGIPGTPGDCIDRQEILPVGSGIPG
FQPAIPCGTPGPPGLRGPPGLPGDKGETGPQGFPGLSRPGYPGRKGYVGAPGPGIPGPPG
FVGPRGDPGSPGPPGSTGNTGLPGLPGRPGATGEKGLPGDAIGAVPGYPGEPGQPGHPGS
KGEKGDAGGIGWKGADGVSGVKGLIGEEGKPGLPGPTGVPGVRGPPGAKGQDGSPGLQGI
PGFPGPQGSFGFKGDRGDRGSPGPAGMKGLPGIPGIQGPHGDAGFPGSPGRFGVDGLPGL
DGLKGLKGSPGMAGFPGVKGFQGRPGLSGLKGEAGSPGIIGNWGPTGVKGIKGDRGQTGP
PGPPPPIEPAMMVRVKGEKGDDGLPGEPGFVGPRGSKGMPGYPGQQGHPGLPGTPGQQKG
IPGFPGVPGEPGSKGMPGAPGPPGIRGFPGMFGEKGVSGNPGLPGRLGTPGSPGLKGDLG
DTINIPGSPGYKGKIGDLGLKGASGPPGLPGKRGSPGEPGIEGLKGSLGDQGFTGKQGSP
GYPGLVGDRGSRGPGGSTGPKGFMGFPGYRGAKGSLGPDGLPGLDGLKGNKGFPGSPGLN
ARGTPGQTGHQGEKGERGIPNTRPGEPGLPGGVGPIGDVGEPGLVGSMGPPGDPGPVIPS
NKPGKAGDPGPKGYDGPQGYPGQPGPFGRLGQPGNKGEIGNPGASGFIGSLGIHGEKGTS
GLPGINGIPGIKGQRGDQGIMGYPGKAGPQGDPGVPGQKGSVGLAGLLGLPGPQGPAPSP
QPFTAPRGADGAPGNPGQRGFRGDPGPKGVPGDEGVKGPPGKPGIPGLTGSPGRIGPRGE
AGPVGQQGSLGFKGVPGTQGVRGMEGMPGRSVSVGYLLVKHSQSQEIPPCPLGMNKLWDG
YSLLFVEGQEKAHNQDLGLAGSCMPRFSTIPFVYCNINNVCYFASRNDKSYWLSTNAPIP
MMPVADAEIKQYISRCSVCEAPSLAVAVHSQDITIPMCPTGWRSLWIGYSFLMHTAAGSE
GGGQSLVSPGSCLEDFRTTPFVECNGARGTCHYFANKHSFWLSTVDPSQQFKEQPVPDTL
KAGQLLTRVGRCQVCMKNL
NT seq
5100 nt
NT seq
+upstream
nt +downstream
nt
atgtggtgcctgttattacgattactcattctgttgctgttgactgacacaattcttgct
ggtggaaagtcatacttaggaccctgcaacgggagagactgcagcgcaggatgtcagtgt
ttcccggaaaaaggagccagaggccggccgggtgcgccaggatctcagggaccacaaggt
ccccctgggcctccgggacgacagggagttgctggacataaaggagcgaaaggtgaccga
ggcaaacctggagtgaccggacaaactggagacaagggaccaatgggagtgcccgggttt
gcaggcaatgatggcataccaggtcacccaggacagccaggcccccggggacctcctgga
cacgatggttgcaatgggacaagaggcgatcccggagccacgggtcaacctggatttcct
ggtttgttgggcatttctggagtacctggaaggaaaggacaaaagggagaaccattcctc
gttacagtcgagtggaggagatttaggggggacgctggcctccctggtctcccaggatac
ccgggcttacctggcaaccctggagagatgggtctcaacggtcccccaggagcgatgggc
ccagtgggtcgtccaggacctccaggacctccaggacccaagggcaatgatggaatcggt
ttccaggggcgaactggtgaaaagggtgagcccggtccgcctggtctacctgggagcagg
atcgaggacaccagccaagtttctgcactggggaataaaacgggagaaaagggtgacaga
ggagaaccaggaaatgaaggcgaattcggtgaccctggggaaccaggaactcctggccca
aaaggtgagaaaggagaagagggaatcatgggccttccaggattaaggggtgagagtggc
ttcaatggacccccaggttctgaaggacgcaaaggtctcccaggtatcccaggtcttccc
gggtttaatggtcaaccaggattgaagggtgaccgaggtgacccaggccaacctggccag
tccatcacatttactggattaattcccaaaggtccaaaaggttggccaggactagaagga
gagcgtggccccaaaggggaggaaggcttctacggccatgagggctcctctggtctccct
ggtgaaacagcgccattcccaggtaacccaggaccaccaggtttaccaggtttctcagga
gccaaaggggagaaaggtgatcagggcttgccagctctccagcctggattcccaggattt
ccagggaaatcaggcccacctggcccacctggacctcctggaccgataggttccacagag
ttcattggagatccaggagaggaaggtcagagagggtaccctggtccaagaggaagacca
ggagacaaaggtgaccgaggacattgtgcctgtgatgtggatggagcttctcctgttggt
ccccggggtcctgctggagccccgggctatccaggcatacccggggtggatgggcagccg
ggagatgaaggatcaccaggtccttttggagcaccagggattcaaggagtgactggtgag
gctggagctcatggccctaaaggacagaaaggagattccgttttcatctccaccataacc
acgaaaggttccaaaggagagcaaggacatccaggattaacaggacgacccggagagcct
ggtattccaggaaatgatgggaaaccaggcagacaaggatatccaggaatcccaggcgat
gctttggaaggttaccctggtgatgtaggtagcccaggtgtcctgggcagaaaaggaatc
ccagggagacctggcctgccaggagttggcattcagggacctcggggaagaccagggcct
cctggtgactttggacctgctggtacaccagggattccaggactcccaggcatccctgga
actccaggtgactgcattgacagacaggaaatcctgccggtgggcagtggtatcccagga
ttccaaccagcgattccctgtggaactccaggacctccaggactaaggggcccaccaggt
ttgcccggagataaaggtgagactggtccacagggattcccaggattatcccgaccagga
tacccaggaaggaaaggttatgttggtgctccagggccaggaattccagggccaccaggt
tttgttgggccccgtggagatcccggttcaccaggcccacctgggtcaactgggaatact
gggcttccgggactaccgggaaggccaggagcaactggtgaaaaaggcttgcccggagat
gcaattggggcagtgccgggataccccggggaaccaggccaaccaggtcatccaggatcc
aaaggagaaaaaggagatgccggaggaattggatggaaaggtgcggatggagtatcggga
gttaaagggctcattggtgaagaaggcaaaccaggcctacctggccctacaggagttcca
ggagtgaggggaccacctggggccaaggggcaggatgggtcaccagggttacaagggata
cctggttttccaggccctcaaggttcttttggtttcaaaggggatcgtggtgacagaggg
tcccccggcccagctggaatgaaaggtttgcctggaattcctggtatccagggaccccat
ggggatgcaggattccccggatcccctggtcgcttcggagtggatggtctgccaggtctt
gatggcctgaaaggtctgaaaggttctccaggaatggcgggattccccggcgtgaagggg
tttcagggtcgacctggcctgtccggcttgaagggagaagcgggatcccctggaattata
gggaactggggtccaactggagtgaagggtattaaaggtgaccgtggacaaacgggacct
ccaggaccacccccacctatcgaacctgccatgatggtgagagtgaagggggagaaagga
gacgacggtttacctggggaacccggatttgttggtcccagagggtcgaaggggatgccg
ggatatccaggacagcaaggacatcctggtctcccgggaactccagggcaacagaaagga
attccagggtttccgggagtaccaggagaacctggaagcaaagggatgccgggagcccct
ggaccaccaggcatcagaggctttcctgggatgtttggtgagaagggcgtctcaggaaac
cccggcctccctgggcgcctcggtaccccaggctcacccggattgaaaggtgacctaggg
gatacgattaacattccagggagtcctggttacaagggcaaaattggcgatctaggattg
aaaggagcatcgggtccccctgggctaccaggcaaacgtggatctccaggagaaccaggc
attgagggcctgaaaggatctctaggtgatcagggattcacaggtaaacagggttctcct
ggttatcccgggttagtgggagacagaggatcgcgaggtcctggtggctcaactggtcca
aagggattcatgggatttccaggatatcgaggagctaaaggttcactgggtcctgatggt
ctgcctggtttagatgggttaaaaggaaacaaaggcttcccaggatccccaggtctaaat
gcgagaggaactccaggtcaaactggtcaccagggtgagaaaggggagagagggataccc
aatacccgaccaggggaaccagggctaccagggggagttggtcccataggtgatgtcggt
gaaccaggtcttgttggctcaatgggacctccaggtgatccagggcctgtgatcccttcg
aacaaaccaggaaaagcaggtgatccagggccaaaaggatatgacggtccacaaggctac
cctggtcaaccgggtccctttggcaggttgggacaacctggaaacaagggtgagataggg
aatccaggtgcatctggcttcataggatcactagggatccacggtgagaagggaacttct
ggtcttccaggtatcaatggcattcctggaattaaaggtcaaagaggtgaccagggtata
atgggttaccctgggaaagctggaccacaaggagaccctggagttcctggacagaaaggt
tcagtgggtctcgctggtttattgggattgcctggcccacagggaccagctccttctccc
caaccattcactgcaccgcggggagctgatggcgccccaggaaatcctgggcagcgtgga
tttcgaggggacccaggtccaaagggggttcctggggatgaaggtgtgaagggccctccg
ggtaaaccaggaatccctgggctcactggctccccaggaagaataggccccagaggtgaa
gcaggtccagtcggacaacaaggatctttgggatttaaaggtgtccctggcacccaaggg
gtacgcgggatggaaggtatgccaggccgaagtgtcagtgttggatacctcttggttaaa
cacagtcagtcgcaggaaatcccaccgtgtccgcttggaatgaacaaactctgggatgga
tacagtctgttatttgtggaaggacaggaaaaagctcacaatcaggatctggggctggct
ggatcgtgtatgccaaggttcagtacaataccctttgtgtactgtaacatcaataatgtt
tgctactttgcaagccgaaatgacaagtcttattggttgtctaccaatgctccgattcca
atgatgcctgtggctgatgccgaaatcaaacagtacatcagccggtgctcagtgtgtgag
gctccgtctctggcagtcgctgttcacagccaggacatcacaattccaatgtgccccact
gggtggcgcagtctgtggattggttactcttttctaatgcacacagctgcaggcagtgaa
ggtggtggtcagtccttggtgtcaccaggcagctgcctggaggatttccgaaccactcct
tttgtggaatgcaatggtgctcgcggcacgtgccattacttcgccaacaagcacagtttc
tggctatcgactgttgaccccagccagcagtttaaggagcagcccgtccctgacactctg
aaggcaggacagcttctaacccgagtcgggcggtgccaagtctgcatgaagaatttataa
DBGET
integrated database retrieval system