Hoeflea sp. IMCC20628: IMCC20628_01977 Help Entry IMCC20628_01977   CDS       T03926                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism hoe  Hoeflea sp. IMCC20628 Pathway hoe02024   Quorum sensing hoe03018   RNA degradation Brite KEGG Orthology (KO) [BR:hoe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IMCC20628_01977  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IMCC20628_01977  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hoe03019]     IMCC20628_01977    03036 Chromosome and associated proteins [BR:hoe03036]     IMCC20628_01977 Messenger RNA biogenesis [BR:hoe03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IMCC20628_01977 Chromosome and associated proteins [BR:hoe03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IMCC20628_01977 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AKI00682 UniProt:  A0A0F7PHJ4 LinkDB All DBs Position 2047178..2047426 Genome browser AA seq 82 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFENEDAATGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttcacaaaatctgcaggacctatttctcaacacggttcggaaacagaaa atctcgctgacgatcttcttgatcaacggagtgaagttgaccggtgtggtcacctcattt gataatttctgcgtcctgctgaggcgcgatggtcattcgcagcttgtctacaagcatgcg atttccacgatcatgccgagtcaaccggttcaaatgtttgaaaatgaggacgccgcaacc ggcgcctga

DBGET integrated database retrieval system