KEGG   Hoeflea sp. IMCC20628: IMCC20628_02452
Entry
IMCC20628_02452   CDS       T03926                                 
Name
(GenBank) putative permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IMCC20628_02452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hoe02000]
    IMCC20628_02452
Transporters [BR:hoe02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    IMCC20628_02452
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AKI01150
LinkDB
Position
2552020..2553219
AA seq 399 aa
MKQIERYILRRMSSLTFWSLTAVTLLVMTTQVLVRVDVLTTTGQALSAFLLLAATLIPSV
LSIVAPFALLIGVSQVLSGMNADSELVVIEAAGVPPATVLKPVLVLSAVLSILVLLVNNF
VEPWSNRKLYDVLAQAQSDLFSVAVRSGTFMRLENGLYVQVNEKLPGGELGGIFLADSRT
EGNESIYYARSGVVKTVGETNILYLVDGELQQRNLSNNQISIVTFTSYALDMAAFVPAGG
ASARRPKEQSTLYLLDPAEDDYYVQKADFVIKQELVQRFSTWMYPLAFGLVAFTFLGKAR
SNRHEQFQNGAIVAGITLGTRGFGFYSGDEAGSSVFMEVLTYAIPAGIIVVFGFLALTGR
TLTIPRAWARLNDRLIEYVRGKFDRRKRQRQASTESGSA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaagcaaatcgaacgttacatattgcgccgaatgagttcgctgaccttttggtcgctg
acggcggtaacgctgcttgtgatgaccacgcaggtgctggttcgcgtcgatgtgctgacc
accaccggtcaggcgctcagcgcgttccttttgctggccgccaccctgattccgtcggtg
ctgtcgatcgtggcgccgtttgcattgctgatcggggtaagccaggtcttgtcaggcatg
aatgccgacagcgaactggtggtgatcgaggcagccggcgttccaccggcgactgtgctc
aaacccgtgctggtgttgtctgcggtgctttcgatcctggtgcttctggtcaacaacttt
gtcgagccatggtcaaaccgcaagctttatgacgtgcttgcccaggcacaatcggatctg
ttttcggttgcggttcgttccggcaccttcatgcgcctggaaaacggactctatgtgcaa
gtcaacgaaaagctgcctggcggtgaactgggtggaattttcctggctgattcacggacg
gagggcaacgaatccatctattacgcccgcagcggcgtggtcaaaaccgtcggtgaaacc
aacatcctatatttggtcgatggcgagttgcagcaacgcaacctgagcaacaaccagata
tcgattgttacattcacctcttatgcgctggacatggccgcttttgtccccgctggcggg
gcttcggcacgcaggccgaaggaacagtccacgctctatcttctcgatccggcggaggat
gactattatgtccagaaggccgactttgtgatcaagcaggaattggtgcagcggttttct
acatggatgtaccccctggctttcgggctcgtcgccttcacgtttctgggcaaagcccgc
tcaaaccggcatgaacagtttcagaacggcgccatcgtggcaggcatcacgctgggcacc
cgcggctttggcttttacagcggcgatgaagccggctccagtgttttcatggaggttttg
acctacgcgatccccgccgggatcattgttgtcttcggtttcctggccctgaccggcagg
acgctgacgatccccagggcatgggctcgcctcaatgaccggctcatcgagtatgtacgg
ggtaagttcgaccgacggaagcgccaacgccaggcatcgaccgagagtggttcggcatga

DBGET integrated database retrieval system