Haliangium ochraceum: Hoch_5650 Help Entry Hoch_5650         CDS       T01103                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hoh  Haliangium ochraceum Pathway hoh01100   Metabolic pathways hoh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hoh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hoch_5650    00074 Mycolic acid biosynthesis     Hoch_5650   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hoch_5650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ACY18127 UniProt:  D0LGA2 LinkDB All DBs Position complement(7755085..7755327) Genome browser AA seq 80 aa AA seqDB search MSESTEKKVKEIIANQLEVQENDLKPGASFTDDLKADSLAVVELVLALEQEFDIEIPDEE TEKIKTVSDAINYIKTHANG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaagcaccgagaagaaagtcaaagagatcatcgccaaccagctcgaggttcag gagaacgacctcaagcccggagcttcgttcaccgacgatctcaaggctgattcgctcgcc gtggtcgagctggtgctcgcgctcgagcaggagttcgacatcgagatcccggacgaggag accgagaaaatcaagacggtcagcgacgcgatcaactacatcaaaacccacgccaacggc tag

DBGET integrated database retrieval system