Vreelandella olivaria: HORIV_00760 Help Entry HORIV_00760       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism hol  Vreelandella olivaria Pathway hol02020   Two-component system hol02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:hol00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     HORIV_00760  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     HORIV_00760  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:hol02035]     HORIV_00760 Bacterial motility proteins [BR:hol02035]  Flagellar system   Flagellar assembly proteins    Others     HORIV_00760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  BBI47655 LinkDB All DBs Position complement(52602..52868) Genome browser AA seq 88 aa AA seqDB search MNIDNINSLLRSNQAQQRDETQKANSVTPATPGGTTRESTQLSQTSIDESQDIDSAKVEE IRDAIREGRLEMSADRIAEGLIANLKDF NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtgaatattgataacattaattcgctgttacgctctaaccaagcccagcagcgcgatgaa acgcaaaaggctaatagcgtgactccggcaacgcccggtggtacaacgcgcgaatcgact caattgagccaaacaagtatcgatgaatctcaggatatcgatagcgccaaagttgaagaa atccgtgacgctattcgtgagggccgcctggaaatgagtgctgatcgcatcgccgagggc ctcattgcaaatcttaaagatttttaa

DBGET integrated database retrieval system