Vreelandella olivaria: HORIV_10760 Help Entry HORIV_10760       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K00891   shikimate kinase [EC:2.7.1.71] Organism hol  Vreelandella olivaria Pathway hol00400   Phenylalanine, tyrosine and tryptophan biosynthesis hol01100   Metabolic pathways hol01110   Biosynthesis of secondary metabolites hol01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     HORIV_10760 Enzymes [BR:hol01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.1  Phosphotransferases with an alcohol group as acceptor     2.7.1.71  shikimate kinase      HORIV_10760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SKI Motif Other DBs NCBI-ProteinID:  BBI48655 LinkDB All DBs Position 767255..767536 Genome browser AA seq 93 aa AA seqDB search MVYLLTTVDQQLKRTAKDRNRPLLQCANREQVLNDMFAQRDPLYRATSDIAVRTDRRSPR AVVNEILRRVHRLVDPLEPSSPSAGTLNHKVSQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtggtctacctgctgacgaccgtcgaccagcagctcaaacggacggcgaaagatcgcaac cggccgctactgcagtgcgccaaccgcgagcaggtgctcaacgacatgtttgcccagcgc gacccgctctatcgcgccacctcggatattgccgtgcgcaccgaccggcgcagcccccgg gcggtggttaatgaaatcctgcgccgggtgcaccggctggtggatccactggagccctca tctccgtcggctggaacgcttaaccataaggtatcgcaatga

DBGET integrated database retrieval system