Vreelandella olivaria: HORIV_26360 Help Entry HORIV_26360       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K00411   ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8] Organism hol  Vreelandella olivaria Pathway hol00190   Oxidative phosphorylation hol01100   Metabolic pathways hol02020   Two-component system Module hol_M00151   Cytochrome bc1 complex respiratory unit Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HORIV_26360  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     HORIV_26360  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     HORIV_26360 Enzymes [BR:hol01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.8  quinol---cytochrome-c reductase      HORIV_26360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rieske Motif Other DBs NCBI-ProteinID:  BBI50215 UniProt:  A0ABN5WTR9 LinkDB All DBs Position 1835032..1835301 Genome browser AA seq 89 aa AA seqDB search MRSIRPEIGVLIGICTHLGCSPLFRPEPDAEGVGVDNWPGGFFCPCHGSRFDLAGRVFNN VPAPTNLEVPPYRFESDDIIIVGEDEEAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt ttgcgctctatcaggcccgagattggggtgctcatcggtatttgcactcacttaggctgt tcgccgctattccggcctgagcccgatgcagagggcgtaggcgttgataactggccgggt ggtttcttctgtccctgccacggttctcgctttgatttggcaggccgggtatttaacaac gttcccgcgccgaccaatcttgaggttccaccctaccgctttgagagtgacgatattatt atcgtcggcgaagatgaggaggctgcctaa

DBGET integrated database retrieval system