Vreelandella olivaria: HORIV_27230 Help Entry HORIV_27230       CDS       T06227                                  Symbol acpP1 Name (GenBank) acyl carrier protein 1   KO K02078   acyl carrier protein Organism hol  Vreelandella olivaria Pathway hol01100   Metabolic pathways hol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HORIV_27230 (acpP1)    00074 Mycolic acid biosynthesis     HORIV_27230 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HORIV_27230 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BBI50302 LinkDB All DBs Position 1891651..1891884 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtgaagaaagttgtagcagagcgcctgaacgttaaagaa gaagacatccaaaacagctcttctttcacagaagacttgggtgctgattcgctcgacacc gttgagctggtaatggctttggaagaggaattcgatactgaaattcctgatgaagaagct gagaagatcaccacggttcaagaagccatcgattacgtgaacgcccaccagtaa

DBGET integrated database retrieval system