Vreelandella olivaria: HORIV_66220 Help Entry HORIV_66220       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism hol  Vreelandella olivaria Pathway hol00260   Glycine, serine and threonine metabolism hol01100   Metabolic pathways Module hol_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     HORIV_66220 Enzymes [BR:hol01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      HORIV_66220     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      HORIV_66220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  BBI54201 UniProt:  A0ABM7GU13 LinkDB All DBs Position complement(4465426..4465599) Genome browser AA seq 57 aa AA seqDB search MWVHAVGCRKFFNVTRHTVSYEILETYKMGEQPSITAANQTQSREAAAVSHQEGVRA NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgtgggtgcacgcggtgggttgccgcaagtttttcaatgtgacgcgtcacaccgtgagc tacgagattctcgagacttacaaaatgggtgagcagccgtcgattaccgctgctaaccaa acgcagtcccgcgaggcggcagcggttagtcatcaagaaggagtgcgggcatga

DBGET integrated database retrieval system