KEGG   Homoserinibacter sp. YIM 151385: OF852_09990
Entry
OF852_09990       CDS       T08733                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
hom  Homoserinibacter sp. YIM 151385
Pathway
hom02024  Quorum sensing
hom03060  Protein export
hom03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    OF852_09990 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OF852_09990 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OF852_09990 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hom03029]
    OF852_09990 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hom02044]
    OF852_09990 (yidC)
Mitochondrial biogenesis [BR:hom03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    OF852_09990 (yidC)
Secretion system [BR:hom02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   OF852_09990 (yidC)
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-ProteinID: WBU37244
LinkDB
Position
2044588..2045589
AA seq 333 aa
MDIIGTILWPIKWVIEAILVGFHTLLELLGMDPAAGLTWVLSIVGLVLIVRAALIPIFVR
QIKSQRKMLEVAPQLKKIQDKYRGKKDQYSREAMQRETMEMYRKAGTSPFASCLPLLIQM
PIFFSLFSVLNEAKPQPDGSFRAGVGLLSQELSEQFGSASLFGIAPLRFSIQSSLEQDPV
NWTVIIIAAVMVILMTASQFITQLQIMSKNQSPEMMASPMFRQQRILLYILPLVFAFSGF
AFPIGVMFYWLVSNFWTMGQQFLVIRNMPTPGSEAALAREARLAKKNRARMADDAQTLAE
EQVAEIEQKKVTTQRQQPVGKNRSKKSGGGAKR
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggacatcatcggcaccatcctctggcccatcaagtgggtcatcgaggcgatcctcgtc
gggttccacaccctgctcgagctcctcggcatggatccggcggccggcctcacctgggtg
ctctcgatcgtcggcctggtcctcatcgtgcgcgccgcgctcatccccatcttcgtgcgc
cagatcaagagccagcgcaagatgctcgaggtcgcgccccagctcaagaagatccaggac
aagtaccgcggcaagaaggatcagtactctcgcgaggcgatgcagcgagagaccatggag
atgtaccggaaggccggcacctcgccgttcgcctcgtgcctccccctgctgatccagatg
ccgatcttcttcagcctcttctcggtgctcaacgaggcgaagccgcagcccgacgggagc
ttccgcgcgggcgtcggcctcctctcgcaggagctgtcggagcagttcggcagcgcctcg
ctcttcgggatcgccccgctgcggttcagcatccagagctcgctcgagcaggacccggtc
aactggaccgtcatcatcatcgccgccgtcatggtcatcctcatgaccgcgtcgcagttc
atcacgcagctgcagatcatgtcgaagaaccagagccccgagatgatggccagcccgatg
ttccggcagcagcgcatcctgctgtacatcctccccctcgtcttcgccttctccggcttc
gccttccccatcggcgtgatgttctactggctcgtctcgaacttctggaccatgggccag
cagttcctcgtgatccgcaacatgccgacgccgggcagcgaggcggcgctcgcccgcgag
gcacgcctcgcgaagaagaaccgcgcccgcatggcggatgacgcgcagacgctggctgag
gagcaggtcgcggagatcgagcagaagaaggtcacgacccagcgccagcagccggtgggc
aagaaccgatcgaagaagtccggcggcggcgccaagagatga

DBGET integrated database retrieval system