Helicobacter pylori HPAG1: HPAG1_0538 Help Entry HPAG1_0538        CDS       T00365                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpa  Helicobacter pylori HPAG1 Pathway hpa01100   Metabolic pathways hpa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPAG1_0538    00074 Mycolic acid biosynthesis     HPAG1_0538   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPAG1_0538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABF84605 UniProt:  Q1CTW7 LinkDB All DBs Position complement(559558..559794) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcactagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttaa

DBGET integrated database retrieval system