Glaesserella parasuis ZJ0906: K756_04655 Help Entry K756_04655        CDS       T02697                                  Name (GenBank) ATPase   KO K06915   DNA double-strand break repair helicase HerA and related ATPase Organism hpaz  Glaesserella parasuis ZJ0906 Brite KEGG Orthology (KO) [BR:hpaz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hpaz03400]     K756_04655 DNA repair and recombination proteins [BR:hpaz03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Archaeal homologous recombinant proteins      K756_04655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HerA_C DUF87 FtsK_SpoIIIE TrwB_AAD_bind AAA_22 ResIII P-loop_TraG AAA_30 CbiA AAA_16 SRP54 T2SSE AAA_7 nSTAND3 AAA_6 AAA AAA_19 Zeta_toxin AAA_25 AAA_28 AAA_18 AAA_5 DUF815 SLFN-g3_helicase NACHT nSTAND_NTPase7 MobB Motif Other DBs NCBI-GeneID:  16165141 NCBI-ProteinID:  AGO16140 UniProt:  A0A806JF34 LinkDB All DBs Position 852750..853097 Genome browser AA seq 115 aa AA seqDB search MNYTIAHSKSGNPISLTAKMANRHGLIAGATGTGKTVTLRKLAETFSNDGVPVFLVDVKG DLSGLVQAGSYQGKIAERIDQFGLGGEAYLNGFPVSFWDVFGEVVEGEGVGLIFM NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaattacaccattgcacacagcaagtcaggcaatcccatttctttaacagccaagatg gcaaaccgccacggtttaattgcaggagcaacaggaacagggaaaactgttacattgcga aaacttgctgaaacttttagcaatgatggcgttcccgtattcctagttgatgtcaaaggt gacttatccggcttagtgcaagcgggaagttatcaaggaaaaattgcagaacgtatcgat caatttggactgggtggtgaagcatatttaaacggatttccagtttctttctgggacgta tttggcgaagtggttgaaggagaaggggttggattgatttttatgtag

DBGET integrated database retrieval system