KEGG   Helicobacter pylori ELS37: HPELS_03670
Entry
HPELS_03670       CDS       T01798                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00540  Lipopolysaccharide biosynthesis
hpe01100  Metabolic pathways
Module
hpe_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPELS_03670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpe01005]
    HPELS_03670
Lipopolysaccharide biosynthesis proteins [BR:hpe01005]
 Lipid A
  HPELS_03670
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFF20280
UniProt: H8H4W3
LinkDB
Position
753559..754677
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMTHQTPPYAFMHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFTILTKEDLSHH
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQFESALESIRFKFARKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELLLSKLENPNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgacgcatcaaacccccccctatgctttcatgcataatcaaacc
ctttcaactgaaagccccccctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaatgataacctcttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aaaactaatcgctggagcgaagccttcactattttaaccaaagaagatctttctcatcat
tcgcatgaatacatcaaaaaattaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaattt
gaaagcgctttagagtcgattcgttttaagtttgcgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacaa
aataacccaagagagcttctaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagattgcgctatcatggcgtttagaaaccattcttttaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatcactgcgccgtaaagaactcttgctttctaaattagaaaacccaaac
tcttttaaaaccttaaaaattttagataaagcggatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctataaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system