Helicobacter pylori ELS37: HPELS_03775 Help Entry HPELS_03775       CDS       T01798                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpe  Helicobacter pylori ELS37 Pathway hpe01100   Metabolic pathways hpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPELS_03775 (acpP)    00074 Mycolic acid biosynthesis     HPELS_03775 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPELS_03775 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  AFF20301 LinkDB All DBs Position 771819..772055 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system