Halopseudomonas pelagia: EAO82_09385 Help Entry EAO82_09385       CDS       T07735                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism hpeg  Halopseudomonas pelagia Pathway hpeg00361   Chlorocyclohexane and chlorobenzene degradation hpeg00362   Benzoate degradation hpeg00623   Toluene degradation hpeg01100   Metabolic pathways hpeg01120   Microbial metabolism in diverse environments hpeg01220   Degradation of aromatic compounds Module hpeg_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:hpeg00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     EAO82_09385    00361 Chlorocyclohexane and chlorobenzene degradation     EAO82_09385    00623 Toluene degradation     EAO82_09385 Enzymes [BR:hpeg01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      EAO82_09385     1.14.13.244  phenol 2-monooxygenase (NADH)      EAO82_09385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QFY56563 LinkDB All DBs Position 1975388..1975660 Genome browser AA seq 90 aa AA seqDB search MSQLAFIVFQDNDNARYIVEAIAQDNPHAEVQHQPALIRIQAEKRLVINRATVEEKIGRE WDVQEMLLDVISIGGNVDEDEDHFILEWKN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagccagctcgcttttatcgtcttccaggacaacgacaacgctcgttacatcgtggaa gccattgcgcaggacaacccccacgccgaagtgcagcaccaacccgcactgatccgaatc caggccgaaaagcgcctggtgatcaaccgagcaacggttgaagagaagatcggtcgggaa tgggacgttcaggaaatgctcctggatgtgatcagtatcggcggcaacgtggatgaggat gaagatcatttcattctcgagtggaaaaattag

DBGET integrated database retrieval system