Halosimplex pelagicum: HZS54_00650 Help Entry HZS54_00650       CDS       T06697                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hpel  Halosimplex pelagicum Pathway hpel03010   Ribosome Brite KEGG Orthology (KO) [BR:hpel00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HZS54_00650   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HZS54_00650  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hpel03011]     HZS54_00650    04121 Ubiquitin system [BR:hpel04121]     HZS54_00650 Ribosome [BR:hpel03011]  Ribosomal proteins   Eukaryotes    Large subunit     HZS54_00650   Archaea     HZS54_00650 Ubiquitin system [BR:hpel04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HZS54_00650 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-CHY Zn_ribbon_RPAB4 Zn_ribbon_3 Zn_ribbon_ZPR1 HVO_0416 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  QLH80221 UniProt:  A0A7D5P6B0 LinkDB All DBs Position 109206..109355 Genome browser AA seq 49 aa AA seqDB search MPKFEPAERRELQKQICMRCNARNSVEATSCRKCGYKNLRRKSKERRNA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgcccaagttcgaacccgcggaacgacgcgagctccagaagcagatctgcatgcgctgc aacgcccgcaactccgtcgaggcgacgagctgccggaagtgcggctacaagaatctccgc cgcaagagcaaagagcgccgcaacgcgtaa

DBGET integrated database retrieval system