Helicobacter pylori F30: HPF30_0767 Help Entry HPF30_0767        CDS       T01895                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpf  Helicobacter pylori F30 Pathway hpf01100   Metabolic pathways hpf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPF30_0767 (acpP)    00074 Mycolic acid biosynthesis     HPF30_0767 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPF30_0767 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAJ56864 LinkDB All DBs Position 821206..821442 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system