Helicobacter pylori Lithuania75: HPLT_02780 Help Entry HPLT_02780        CDS       T01896                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hph  Helicobacter pylori Lithuania75 Pathway hph01100   Metabolic pathways hph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPLT_02780 (acpP)    00074 Mycolic acid biosynthesis     HPLT_02780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPLT_02780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ADU82982 LinkDB All DBs Position complement(552430..552666) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAVQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcaattgaatgtggatgcggtg caagttacgccagaggcagagtttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaggaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system