Helicobacter pylori 908: hp908_0564 Help Entry hp908_0564        CDS       T01893                                  Symbol accP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hpi  Helicobacter pylori 908 Pathway hpi01100   Metabolic pathways hpi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     hp908_0564 (accP)    00074 Mycolic acid biosynthesis     hp908_0564 (accP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     hp908_0564 (accP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  ADN79692 LinkDB All DBs Position complement(542741..542977) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttaccccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttaa

DBGET integrated database retrieval system