KEGG   Helicobacter pylori 908: hp908_0587
Entry
hp908_0587        CDS       T01893                                 
Name
(GenBank) BNR/Asp-box repeat protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00540  Lipopolysaccharide biosynthesis
hpi01100  Metabolic pathways
Module
hpi_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    hp908_0587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpi01005]
    hp908_0587
Lipopolysaccharide biosynthesis proteins [BR:hpi01005]
 Lipid A
  hp908_0587
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADN79715
UniProt: E1S885
LinkDB
Position
complement(560151..561269)
AA seq 372 aa
MESSRNRLKHAAFFVGLFIVSFLIIMKRQTPPYAFTHNQTLVTQNPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNCWSEAFILLTKEELSHY
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQLESALEPIRFKFAQKLSLSPF
LNLSHLVRNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSLKDNLILETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELWLSKLENSNSFKVLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaatcttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
tcatttttaattataatgaagcgccaaacccccccctatgctttcacgcataatcaaacc
cttgttactcaaaaccccccctatttcacgcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgacaatcttttaagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagactaattgctggagcgaagccttcattcttttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaattgggtaaccccttgcttttcttgcatgataataaaatc
ttgttgtttgtggtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcaaaaactctctttaagccctttt
ttaaacttgagccatttagtaaggaataagcctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccctattattgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaataccctaaaccaccagctccaaccaagctta
accccctttaaagactgcgctgtcatggcgtttagaaaccattctcttaaagataatctc
atactagaaacctgcaagacccctaccgcttggcaaaaacccatgctcacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatcactgcgtcgtaaagaactttggctttctaaattagaaaactccaac
tcgtttaaagttttaaaagttttagacaaagccaatgaagtgagttacccaagctatagt
cttaatccgcattttatagatattgtttatacctataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtga

DBGET integrated database retrieval system