Haemophilus pittmaniae: NCTC13334_00385 Help Entry NCTC13334_00385   CDS       T06001                                  Symbol acp_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpit  Haemophilus pittmaniae Pathway hpit01100   Metabolic pathways hpit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13334_00385 (acp_2)    00074 Mycolic acid biosynthesis     NCTC13334_00385 (acp_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13334_00385 (acp_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  SNV64450 LinkDB All DBs Position 1:383465..383716 Genome browser AA seq 83 aa AA seqDB search MTEQEIQTILSEALQSLFEIEPERIKPETNLYQDLEIDSIDAIDLIDYIKRKTGHKLQAE DFRNVRTVDDVVQAVLKLSQKSE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgaacaagaaattcaaacaattcttagcgaagccttgcagtctctctttgaaatc gagccggaaagaatcaaaccggaaaccaatctatatcaagacctagaaattgatagtatt gatgctatcgatcttatcgactacatcaaacgaaaaaccggccataaattacaggctgag gatttccgtaatgtgcgcacggtagatgatgttgttcaagctgtacttaagcttagccaa aaaagtgagtaa

DBGET integrated database retrieval system