Haemophilus pittmaniae: NCTC13334_00844 Help Entry NCTC13334_00844   CDS       T06001                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpit  Haemophilus pittmaniae Pathway hpit01100   Metabolic pathways hpit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13334_00844 (acpP)    00074 Mycolic acid biosynthesis     NCTC13334_00844 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13334_00844 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  SNV70282 LinkDB All DBs Position 1:complement(828659..828889) Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtgaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gacgtaaaacctgaagcttctttcgttgaagatttaggtgcggactctttagatacagtt gaattggtaatggctttagaagaagaattcgatatcgaaattcctgatgaagaagctgaa aaaatcacaactgttcaatctgcgattgactacgttcaaaacaatcaataa

DBGET integrated database retrieval system