KEGG   Vreelandella piezotolerans: GYM47_01880
Entry
GYM47_01880       CDS       T07036                                 
Name
(GenBank) YggS family pyridoxal phosphate-dependent enzyme
  KO
K06997  PLP dependent protein
Organism
hpiz  Vreelandella piezotolerans
Brite
KEGG Orthology (KO) [BR:hpiz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    GYM47_01880
SSDB
Motif
Pfam: Ala_racemase_N
Other DBs
NCBI-ProteinID: QJA22947
LinkDB
Position
complement(398019..398717)
AA seq 232 aa
MTDNALSESLASARERLRRALEEAGRSPTSATLLAVSKTKPADMLREAWQHGQREFGENY
LQEALDKQAALKDLDGIVWHFIGPLQSNKTRAVAEQFAWVHSVDRLKIAKRLSEQRPAAL
PPLNVCLQVNISREATKSGVLPEDALALARDIAALPGLALRGLMAIPAPAATLEAQRQPL
AALRQLLDELKAALPDAPLDTLSMGMSDDLEAAVLEGATLVRLGTAIFGARG
NT seq 699 nt   +upstreamnt  +downstreamnt
atgacagacaacgcgctctccgagtcactggcctctgcgcgtgaacgcctgcgacgagcg
cttgaagaagcagggcgctcgcccaccagcgctactctgttagcggtgagcaagaccaag
cccgccgacatgctgcgcgaagcgtggcagcacggccagcgcgagtttggtgaaaactac
ctgcaagaagcgctggataaacaggcggcgctcaaggatcttgacggcatcgtgtggcac
ttcatcggcccgctgcaatcgaacaagacccgtgccgtggccgagcagtttgcctgggta
cacagcgtggatcgtttgaaaattgccaaacgtttgagcgaacagcgcccagcagcgcta
ccgccgctgaacgtctgcctgcaggtcaacattagccgcgaggccacgaagtccggcgtg
ctgccggaagatgccttggctttggctcgagacattgccgcgctacccggcttagccctg
cgcgggctgatggcgattcccgccccagcggcgacgctagaggcacagcgccagccgctg
gcagcgctgcgccagctattggatgagctcaaagcggcactgcccgatgcgccgctggat
acgctatcgatgggcatgagtgacgatttggaagcggctgttttagagggcgccacgctg
gtacgtttaggcaccgccatttttggcgcccggggctaa

DBGET integrated database retrieval system