KEGG   Vreelandella piezotolerans: GYM47_05215
Entry
GYM47_05215       CDS       T07036                                 
Name
(GenBank) GlsB/YeaQ/YmgE family stress response membrane protein
Organism
hpiz  Vreelandella piezotolerans
SSDB
Motif
Pfam: Transgly_assoc
Other DBs
NCBI-ProteinID: QJA23555
LinkDB
Position
1130978..1131220
AA seq 80 aa
MGFIAWLIIGGLAGWIAGNIMRGGGFGVLGNIGVGVVGALVGGFLFSLLGLQAGGFIGSL
VTATVGAVVLLWVISKVKSA
NT seq 243 nt   +upstreamnt  +downstreamnt
atgggctttattgcgtggttaatcattggtggtttagctggctggatcgccggcaacatc
atgcgtggcggcggctttggcgtgctcggtaacattggcgtcggcgtggtcggtgcgctc
gtcggtggtttcctattcagcctgctggggctgcaggcgggcggcttcatcggctcgctc
gtcacggcgaccgtgggggccgtggtcttgttatgggtcattagtaaagttaaaagcgcc
tag

DBGET integrated database retrieval system