Vreelandella piezotolerans: GYM47_10380 Help Entry GYM47_10380       CDS       T07036                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpiz  Vreelandella piezotolerans Pathway hpiz01100   Metabolic pathways hpiz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpiz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GYM47_10380 (acpP)    00074 Mycolic acid biosynthesis     GYM47_10380 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GYM47_10380 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QJA24475 LinkDB All DBs Position complement(2265015..2265248) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtaaaaaaagtagtggcagagcgcctgaacgttaaagaa gaagacatccagaacagctcttctttcactgaagacctgggtgccgactctctggacacc gttgaactggtgatggcattggaagaggaattcgatactgaaattcctgacgaagaagcc gaaaaaatcaccacggttcaagaagcgatcgactacgtaaacgcccaccagtaa

DBGET integrated database retrieval system