Vreelandella piezotolerans: GYM47_17520
Help
Entry
GYM47_17520 CDS
T07036
Name
(GenBank) MFS transporter
KO
K19577
MFS transporter, DHA1 family, inner membrane transport protein
Organism
hpiz
Vreelandella piezotolerans
Brite
KEGG Orthology (KO) [BR:
hpiz00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
hpiz02000
]
GYM47_17520
Transporters [BR:
hpiz02000
]
Major facilitator superfamily (MFS)
Drug transporters
Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:
2.A.1.2
]
GYM47_17520
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
MFS_4
Motif
Other DBs
NCBI-ProteinID:
QJA25753
LinkDB
All DBs
Position
complement(3817423..3818634)
Genome browser
AA seq
403 aa
AA seq
DB search
MQSSSTELARHPRWAEFVLALGGFGIGTSEFVIMGLMNRVAEDLAVSVPQVGYSISSYAL
GVVVGAPLISTLAARVPKRALLIALMLVFALGNIASAMAPGFWSFVGLRFLAGLPHGAYF
GVAALVAAGAVPVDQRARAIARVMMGLTVAILIGAPLGTWAGNLLGWQIAFAAVGGIALL
TALLIRLFVPVQPVDAHASPLRELSALVKQRVLVTIAIACIGCGGMFSIFSYVMPTLTQQ
AGMSEALGPLVLVIFGLGSIAGNLVGGRMADKNLMRAIPTILVWCAVVQGLFYFAANQVW
SGLLFVGLVGTSIALAPSLQTRLMDVAEDAQTMAASMNHAAFNGANALGAWLAGLAISAG
FSWSSTGLVGSGLALCGLVIFAWGRWLEKRTGSAQPTVAHGCK
NT seq
1212 nt
NT seq
+upstream
nt +downstream
nt
atgcaatcatcatcaacggagctggcgcggcatccgcgatgggcggagttcgtgctggcg
ctgggcgggttcggcatcggcaccagcgaattcgtcatcatggggttgatgaaccgcgtg
gcggaagacctagccgtgagcgtgccgcaagtaggctactccatcagcagttatgcgctg
ggggtcgtggtgggggcgccgctaatctcgacactggccgcgcgggtgcctaaacgagcc
ctgctgatcgcactgatgttggtatttgctttgggcaacattgccagcgccatggccccg
ggattttggtcgttcgtcgggctgcgctttttagcagggctgccccatggggcgtatttt
ggtgtggcggcgctggtggccgccggcgcggtgccggtcgatcaacgggcgcgcgccatc
gcccgcgtcatgatggggctgacggtggccatcctaatcggtgcgccgttgggcacctgg
gcgggtaacctgttgggctggcagatcgcctttgcggcggtcggcggcattgcgctgctc
acggcgctgttgattcgcctgtttgtgcctgtgcagcctgtcgatgctcacgccagcccg
ttgcgagagctttccgcactggtcaaacagcgcgtgctggtgaccattgcgattgcctgt
atcggctgcggcggtatgttttcgatcttcagttatgtcatgccgacgctgacccagcag
gcgggcatgagcgaagcgctgggacctttggtgttggtcatctttggcctgggctccatc
gccggtaacttggtgggcgggcgcatggcggataaaaacctgatgcgggccattcctacc
attttggtgtggtgcgctgtggtgcaggggctgttctactttgctgccaaccaggtgtgg
tcgggactgctgttcgtggggttggtcggcaccagcattgcgctggccccgtcgttgcaa
acgcggctgatggacgtggccgaagatgcccaaaccatggcggcctccatgaaccacgcg
gcattcaacggtgccaatgcgctgggcgcgtggctggcgggcttggcgattagcgctggg
tttagctggtcgagcacgggactggtcgggtcggggcttgcgctgtgtggcctggtgatt
tttgcctgggggcgctggctggagaagcgcacggggtcagcgcaaccaacggttgctcat
ggttgtaaataa
DBGET
integrated database retrieval system