Helicobacter pylori J99: jhp_0276 Help Entry jhp_0276          CDS       T00020                                  Name (GenBank) putative   KO K04093   chorismate mutase [EC:5.4.99.5] Organism hpj  Helicobacter pylori J99 Pathway hpj00400   Phenylalanine, tyrosine and tryptophan biosynthesis hpj01100   Metabolic pathways hpj01110   Biosynthesis of secondary metabolites hpj01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:hpj00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     jhp_0276 Enzymes [BR:hpj01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      jhp_0276 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 ARM_At3g06530 Motif Other DBs NCBI-ProteinID:  AAD05867 UniProt:  Q9ZME4 LinkDB All DBs Position 305191..305493 Genome browser AA seq 100 aa AA seqDB search MQKNLDSLLENLRAEIDALDNELSDLLDKRLGIALKIALIKQESPQENPIYCPKREQEIL KRLSQRGFKHLNGEILASFYAEVFKISRNFQENALKELKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcaaaagaatttggatagtcttttagaaaatttaagggctgaaattgatgcgttggat aatgaattgagcgatcttttagacaaacgcttaggaatcgctttaaaaatcgctctcatc aaacaagaaagcccccaagaaaaccccatttattgccctaaaagagagcaagagatttta aaacgactcagccaaaggggtttcaagcatttgaatggagaaatccttgcaagtttttat gcagaggtttttaagatttctagaaattttcaagaaaacgccctaaaagagttaaaaaaa taa

DBGET integrated database retrieval system