KEGG   Helicobacter pylori J99: jhp_0527
Entry
jhp_0527          CDS       T00020                                 
Name
(GenBank) putative
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpj  Helicobacter pylori J99
Pathway
hpj00540  Lipopolysaccharide biosynthesis
hpj01100  Metabolic pathways
Module
hpj_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    jhp_0527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpj01005]
    jhp_0527
Lipopolysaccharide biosynthesis proteins [BR:hpj01005]
 Lipid A
  jhp_0527
SSDB
Motif
Pfam: BNR_2
Other DBs
NCBI-ProteinID: AAD06108
UniProt: Q9ZLQ1
LinkDB
Position
complement(574642..575760)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMKHQTSPYAFTHNQALVTQTPPYFTQLTIPKPNDA
LSAHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFILLTKEELSHH
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQFESALEPIHFKFARKLSLSPF
LNLSHLVRNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTDWQKPISTNLKNLDDSLNLLNLNGILYLIHN
PSDLSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttgtttttaattataatgaagcaccaaacctccccctatgctttcacgcataatcaagcc
cttgtcactcaaacccccccctatttcacgcaactcactatccctaaaccaaatgacgct
ttaagcgcgcatgcgagctctttaatcagcttgcctaacgacaatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagactaatcgctggagcgaagccttcattcttttaaccaaagaagagctttctcatcat
tcgcatgaatacatcaaaaaattaggtaaccccttgctttttttgcatgataataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaattt
gaaagcgctttagagccgattcattttaagtttgcgcgaaaactctctttaagccctttt
ttaaatttgagccatttagtaaggaataagcctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaataccttaaaccaccagctccaaccaagctta
accccctttaaagactgcgctgtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccactgattggcaaaaacccatttctacaaatcttaaa
aacttagatgattctttaaatttactcaatttaaatggaatattgtatttgatccacaac
cctagcgatttatcactgcgtcgtaaagaactttggctttctaaattagaaaactccaac
tcgtttaaaaccttaaaagttttggataaagcgaatgaagtgagttacccaagctatagc
cttaatccgcattttatagatattgtctatacttacaaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtga

DBGET integrated database retrieval system