Helicobacter pylori SJM180: HPSJM_02835 Help Entry HPSJM_02835       CDS       T01323                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpm  Helicobacter pylori SJM180 Pathway hpm01100   Metabolic pathways hpm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSJM_02835 (acpP)    00074 Mycolic acid biosynthesis     HPSJM_02835 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSJM_02835 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  ADO02159 UniProt:  E1PZ18 LinkDB All DBs Position complement(563494..563730) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttaccccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttag

DBGET integrated database retrieval system