Helicobacter pylori India7: HPIN_04075 Help Entry HPIN_04075        CDS       T01918                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpn  Helicobacter pylori India7 Pathway hpn01100   Metabolic pathways hpn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPIN_04075 (acpP)    00074 Mycolic acid biosynthesis     HPIN_04075 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPIN_04075 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADU80043 UniProt:  E8QGD1 LinkDB All DBs Position 827751..827987 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttaa

DBGET integrated database retrieval system