Helicobacter pylori 35A: HMPREF4655_21041 Help Entry HMPREF4655_21041  CDS       T01892                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpo  Helicobacter pylori 35A Pathway hpo01100   Metabolic pathways hpo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HMPREF4655_21041 (acpP)    00074 Mycolic acid biosynthesis     HMPREF4655_21041 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HMPREF4655_21041 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADU41136 LinkDB All DBs Position 1025270..1025506 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAVQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgcggtg caagttacgccagaggcggaattcgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system