Helicobacter pylori 2017: hp2017_0543 Help Entry hp2017_0543       CDS       T01913                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hpq  Helicobacter pylori 2017 Pathway hpq01100   Metabolic pathways hpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     hp2017_0543 (acpP)    00074 Mycolic acid biosynthesis     hp2017_0543 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     hp2017_0543 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N ACP_SdgA_C PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ADZ49636 LinkDB All DBs Position complement(541763..541999) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttaccccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttaa

DBGET integrated database retrieval system