Helicovermis profundi: HLPR_05240 Help Entry HLPR_05240        CDS       T09891                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hprf  Helicovermis profundi Pathway hprf00020   Citrate cycle (TCA cycle) hprf00720   Other carbon fixation pathways hprf01100   Metabolic pathways hprf01110   Biosynthesis of secondary metabolites hprf01120   Microbial metabolism in diverse environments hprf01200   Carbon metabolism hprf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hprf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HLPR_05240   09102 Energy metabolism    00720 Other carbon fixation pathways     HLPR_05240 Enzymes [BR:hprf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HLPR_05240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_15 Fer4_8 Fer4_22 Fer4_17 Fer4_3 Fer4_13 BD_b_sandwich Fer4_18 Motif Other DBs NCBI-ProteinID:  BEP28193 UniProt:  A0AAU9E1M1 LinkDB All DBs Position 599686..599913 Genome browser AA seq 75 aa AA seqDB search MAKAKGKVEFKEDICKGCGLCVNACPVNIISLDNDRINVKGYHPAFVAEMDKCIGCANCA TMCPDSVITVEREMV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaggctaagggtaaagtggaatttaaagaagatatttgtaaaggctgtggactt tgtgtgaatgcttgtccagttaacattatttctttagataatgacagaattaacgttaag ggttatcatccagcgtttgtagcagaaatggataaatgtataggatgtgcaaattgcgct acaatgtgtccggattcagtaattactgttgaaagagaaatggtttaa

DBGET integrated database retrieval system