Helicovermis profundi: HLPR_17390 Help Entry HLPR_17390        CDS       T09891                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hprf  Helicovermis profundi Pathway hprf01100   Metabolic pathways hprf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hprf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HLPR_17390 (acpP_2)    00074 Mycolic acid biosynthesis     HLPR_17390 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HLPR_17390 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF6137 DUF7127 Motif Other DBs NCBI-ProteinID:  BEP29408 UniProt:  A0AAU9E4Q5 LinkDB All DBs Position complement(1968000..1968230) Genome browser AA seq 76 aa AA seqDB search MFNKVKEIIIEQLGVDEGVEIIETTSLMGDLEADSLDAVEIIMALEDEFDIEIPDEDAEK FKNIGDISSYVQGRVK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtttaataaagttaaggaaataataatagagcaactaggtgtagatgagggtgttgaa ataattgaaactacatcacttatgggagatttagaggctgattcattagatgctgtggaa ataataatggctcttgaagatgaatttgatatagaaattcctgatgaagatgctgaaaaa ttcaaaaatattggtgatatttcatcgtatgttcaaggtagagtaaaataa

DBGET integrated database retrieval system