Halomonas profundus: LMS44_02235 Help Entry LMS44_02235       CDS       T08361                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism hpro  Halomonas profundus Brite KEGG Orthology (KO) [BR:hpro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hpro03036]     LMS44_02235 (zapB) Chromosome and associated proteins [BR:hpro03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LMS44_02235 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TolA_bind_tri Nuf2_DHR10-like YabA Tup_N GAS DUF7310 XRCC4_CC FlaC_arch FliD_C PCRF DivIC Prominin Motif Other DBs NCBI-ProteinID:  UEQ04700 LinkDB All DBs Position complement(467511..467705) Genome browser AA seq 64 aa AA seqDB search MSLELFNQLEQKVTDTVDALEMMKLENEELRGENAKLKEEREEWERRLNSLLSKFDSLET SSTP NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagtctggagctatttaatcaacttgagcagaaagtcaccgacactgttgatgcactg gagatgatgaaactggaaaatgaagagctgcgcggcgaaaacgccaagctgaaagaggag cgcgaagagtgggagcgtcgcctcaacagcctgctcagcaagttcgacagcctcgaaacc tccagcacgccttag

DBGET integrated database retrieval system